2e7f/1/1:A/1:B

Sequences

>2e7f-a1-m1-cA (length=262) [Search sequence]

MLIIGERINGMFGDIKRAIQERDPAPVQEWARRQEEGGARALDLNVGPAVQDKVSAMEWL
VEVTQEVSNLTLCLDSTNIKAIEAGLKKCKNRAMINSTNAEREKVEKLFPLAVEHGAALI
GLTMNKTGIPKDSDTRLAFAMELVAAADEFGLPMEDLYIDPLILPANVAQDHAPEVLKTL
QQIKMLADPAPKTVLGLSNVSQNCQNRPLINRTFLAMAMACGLDAAIADACDEALIETAA
TAEILLNQTVYCDSFVKMFKTR

>2e7f-a1-m1-cB (length=262) [Search sequence]

Structure information

PDB ID	2e7f (database links: RCSB PDB PDBe PDBj PDBsum)
Title	5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase complexed with methyltetrahydrofolate to 2.2 Angsrom resolution
Assembly ID	1
Resolution	2.2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	103
Sequence identity between the two chains	1.0
PubMed citation	17172470

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q46389	Q46389
Species	1525 (Moorella thermoacetica)	1525 (Moorella thermoacetica)
Function annotation	BioLiP:2e7fA	BioLiP:2e7fB

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	2e7f-a1-m1-cA_2e7f-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	2e7f-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1f6y/1/1:A/1:B 2ogy/1/1:A/1:B 4djd/1/1:A/1:B 4dje/1/1:A/1:B 4djf/1/1:A/1:B