2e7p/1/1:D/1:A

Sequences
>2e7p-a1-m1-cD (length=101) [Search sequence]
DAALKKAKELASSAPVVVFSKTYCGYCNRVKQLLTQVGASYKVVELDELSDGSQLQSALA
HWTGRGTVPNVFIGGKQIGGCDTVVEKHQRNELLPLLQDAA
>2e7p-a1-m1-cA (length=107) [Search sequence]
SKQELDAALKKAKELASSAPVVVFSKTYCGYCNRVKQLLTQVGASYKVVELDELSDGSQL
QSALAHWTGRGTVPNVFIGGKQIGGCDTVVEKHQRNELLPLLQDAAA
Structure information
PDB ID 2e7p (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the holo form of glutaredoxin C1 from populus tremula x tremuloides
Assembly ID 1
Resolution 2.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 13
Sequence identity between the two chains 1.0
PubMed citation 17460036
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D A
UniProt accession Q5PSJ1 Q5PSJ1
Species 47664 (Populus tremula x Populus tremuloides) 47664 (Populus tremula x Populus tremuloides)
Function annotation BioLiP:2e7pD BioLiP:2e7pA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2e7p-a1-m1-cD_2e7p-a1-m1-cA.pdb.gz
Full biological assembly
Download: 2e7p-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 2e7p/1/1:D/1:C 2e7p/1/1:A/1:B
  • [Back to Home]