2e7s/1/1:A/1:B

Sequences

>2e7s-a1-m1-cA (length=112) [Search sequence]

LEEQLNKSLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKA EEEADKLNKEVEDLTASLFDEANNLVADAREKYAIEILNKRLTEQLREKDLL

>2e7s-a1-m1-cB (length=119) [Search sequence]

LEEQLNKSLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKA EEEADKLNKEVEDLTASLFDEANNLVADAREKYAIEILNKRLTEQLREKDLLDTLTLQL

Structure information

PDB ID	2e7s (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the yeast Sec2p GEF domain
Assembly ID	1
Resolution	3Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	97
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	P17065	P17065
Species	4932 (Saccharomyces cerevisiae)	4932 (Saccharomyces cerevisiae)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2e7s-a1-m1-cA_2e7s-a1-m1-cB.pdb.gz

Full biological assembly Download: 2e7s-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2e7s/2/1:C/1:D 2e7s/4/1:H/1:G 2e7s/6/1:L/1:K 2e7s/7/1:N/1:M 2e7s/9/1:Q/1:R
Other dimers with similar sequences but different poses	2e7s/3/1:E/1:F 2e7s/10/1:T/1:S 2e7s/5/1:J/1:I 2e7s/8/1:P/1:O 2eqb/1/1:B/1:C 4zdw/1/1:B/1:C 2ocy/2/2:A/2:B 2ocy/1/1:A/1:B 2ocy/2/1:A/1:B 2ocy/2/1:A/2:B 2ocy/2/1:B/2:A