2ebg/1/1:A/1:B

Sequences
>2ebg-a1-m1-cA (length=106) [Search sequence]
MQAVRLFQGYLWHPRALALDLKALLPGEVAGARLLWDEVPPPTPFFEDGTPTHTQRFYQL
TLLVLTEEPPEALKPLAEEAAEALGEVLEGLPPEVGWLLLEDLRPL
>2ebg-a1-m1-cB (length=106) [Search sequence]
MQAVRLFQGYLWHPRALALDLKALLPGEVAGARLLWDEVPPPTPFFEDGTPTHTQRFYQL
TLLVLTEEPPEALKPLAEEAAEALGEVLEGLPPEVGWLLLEDLRPL
Structure information
PDB ID 2ebg (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a hypothetical protein from thermus thermophilus
Assembly ID 1
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 90
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q5SM82 Q5SM82
Species 274 (Thermus thermophilus) 274 (Thermus thermophilus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2ebg-a1-m1-cA_2ebg-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2ebg-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2ebe/1/1:A/1:B 2ei5/1/1:A/1:B

[Back to Home]