2ehw/6/1:A/3:B

Sequences

>2ehw-a6-m1-cA (length=114) [Search sequence]

CHELSALRIAIGELLEKEAHDLLHEREELAPVLGQRPELKRLAEAKTLPALEEALREALL HLEERAAQEPEEPYWRGLLLAVEAEGRLKALRAEAEALYQDLDALHGRLHRLFP

>2ehw-a6-m3-cB (length=114) [Search sequence]

CHELSALRIAIGELLEKEAHDLLHEREELAPVLGQRPELKRLAEAKTLPALEEALREALL HLEERAAQEPEEPYWRGLLLAVEAEGRLKALRAEAEALYQDLDALHGRLHRLFP

Structure information

PDB ID	2ehw (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Conserved hypothetical proteim (TTHB059) from Thermo thermophilus HB8
Assembly ID	6
Resolution	2.22Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	106
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	3
Chain ID	A	B
UniProt accession	Q53WA3	Q53WA3
Species	300852 (Thermus thermophilus HB8)	300852 (Thermus thermophilus HB8)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2ehw-a6-m1-cA_2ehw-a6-m3-cB.pdb.gz

Full biological assembly Download: 2ehw-assembly6.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2ehw/5/1:C/2:C 2ehw/5/1:D/2:D 2ehw/6/1:B/3:A
Other dimers with similar sequences but different poses	2ehw/6/3:A/3:B 2ehw/5/1:C/1:D 2ehw/5/2:C/2:D 2ehw/6/1:A/1:B 2ehw/5/1:C/2:D 2ehw/5/1:D/2:C 2ehw/6/1:A/3:A 2ehw/6/1:B/3:B