2ehw/6/3:A/3:B

Sequences
>2ehw-a6-m3-cA (length=114) [Search sequence]
CHELSALRIAIGELLEKEAHDLLHEREELAPVLGQRPELKRLAEAKTLPALEEALREALL
HLEERAAQEPEEPYWRGLLLAVEAEGRLKALRAEAEALYQDLDALHGRLHRLFP
>2ehw-a6-m3-cB (length=114) [Search sequence]
CHELSALRIAIGELLEKEAHDLLHEREELAPVLGQRPELKRLAEAKTLPALEEALREALL
HLEERAAQEPEEPYWRGLLLAVEAEGRLKALRAEAEALYQDLDALHGRLHRLFP
Structure information
PDB ID 2ehw (database links: RCSB PDB PDBe PDBj PDBsum)
Title Conserved hypothetical proteim (TTHB059) from Thermo thermophilus HB8
Assembly ID 6
Resolution 2.22Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 41
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 3 3
Chain ID A B
UniProt accession Q53WA3 Q53WA3
Species 300852 (Thermus thermophilus HB8) 300852 (Thermus thermophilus HB8)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2ehw-a6-m3-cA_2ehw-a6-m3-cB.pdb.gz
Full biological assembly
Download: 2ehw-assembly6.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2ehw/5/1:C/1:D 2ehw/5/2:C/2:D 2ehw/6/1:A/1:B
Other dimers with similar sequences but different poses
  • 2ehw/6/1:A/3:B 2ehw/5/1:C/2:C 2ehw/5/1:D/2:D 2ehw/6/1:B/3:A
  • 2ehw/5/1:C/2:D 2ehw/5/1:D/2:C 2ehw/6/1:A/3:A 2ehw/6/1:B/3:B
  • [Back to Home]