2eis/1/2:B/3:B

Sequences
>2eis-a1-m2-cB (length=117) [Search sequence]
ETRVYPVFPGETNHYGTLFGGTVLAWDQAAFVAATRHARKKVVTVHADAVDFKRPVPLGA
IVELVARLKEVGRTSRVEVEWVEPVKEGEEAYLAARGGFVLVAVDERGRPSPVPPLE
>2eis-a1-m3-cB (length=117) [Search sequence]
ETRVYPVFPGETNHYGTLFGGTVLAWDQAAFVAATRHARKKVVTVHADAVDFKRPVPLGA
IVELVARLKEVGRTSRVEVEWVEPVKEGEEAYLAARGGFVLVAVDERGRPSPVPPLE
Structure information
PDB ID 2eis (database links: RCSB PDB PDBe PDBj PDBsum)
Title X-ray structure of acyl-CoA hydrolase-like protein, TT1379, from Thermus thermophilus HB8
Assembly ID 1
Resolution 2.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 18
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 2 3
Chain ID B B
UniProt accession Q53VX2 Q53VX2
Species 300852 (Thermus thermophilus HB8) 300852 (Thermus thermophilus HB8)
Function annotation BioLiP:2eisB BioLiP:2eisB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2eis-a1-m2-cB_2eis-a1-m3-cB.pdb.gz
Full biological assembly
Download: 2eis-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2eis/1/1:A/2:A 2eis/1/1:A/3:A 2eis/1/1:B/2:B 2eis/1/1:B/3:B 2eis/1/2:A/3:A
Other dimers with similar sequences but different poses
  • 2eis/1/3:A/3:B 2eis/1/1:A/1:B 2eis/1/2:A/2:B
  • 2eis/1/1:A/3:B 2eis/1/1:B/2:A 2eis/1/2:B/3:A
  • [Back to Home]