2ek5/3/2:B/2:A

Sequences

>2ek5-a3-m2-cB (length=108) [Search sequence]

ASLIEDSIVDGTLSIDQRVPSTNELAAFHRINPATARNGLTLLVEAGILYKKRGIGFVSA QAPALIRERRDAAFAATYVAPLIDESIHLGFTRARIHALLDQVAESRG

>2ek5-a3-m2-cA (length=114) [Search sequence]

VPLYKQIASLIEDSIVDGTLSIDQRVPSTNELAAFHRINPATARNGLTLLVEAGILYKKR GIGFVSAQAPALIRERRDAAFAATYVAPLIDESIHLGFTRARIHALLDQVAESR

Structure information

PDB ID	2ek5 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the transcriptional factor from C.glutamicum at 2.2 angstrom resolution
Assembly ID	3
Resolution	2.2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	60
Sequence identity between the two chains	0.991

Chain information

	Chain 1	Chain 2
Model ID	2	2
Chain ID	B	A
UniProt accession	Q8NLJ5	Q8NLJ5
Species	196627 (Corynebacterium glutamicum ATCC 13032)	196627 (Corynebacterium glutamicum ATCC 13032)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2ek5-a3-m2-cB_2ek5-a3-m2-cA.pdb.gz

Full biological assembly Download: 2ek5-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2du9/1/1:A/2:A 2ek5/1/1:B/1:A 2ek5/2/1:D/1:C 2ek5/3/1:B/1:A 2ek5/4/1:D/1:C 2ek5/4/3:D/3:C
Other dimers with similar sequences but different poses	2ek5/4/1:D/3:D 2ek5/3/1:A/2:A