2ek5/4/1:D/3:D

Sequences
>2ek5-a4-m1-cD (length=114) [Search sequence]
VPLYKQIASLIEDSIVDGTLSIDQRVPSTNELAAFHRINPATARNGLTLLVEAGILYKKR
GIGFVSAQAPALIRERRDAAFAATYVAPLIDESIHLGFTRARIHALLDQVAESR
>2ek5-a4-m3-cD (length=114) [Search sequence]
VPLYKQIASLIEDSIVDGTLSIDQRVPSTNELAAFHRINPATARNGLTLLVEAGILYKKR
GIGFVSAQAPALIRERRDAAFAATYVAPLIDESIHLGFTRARIHALLDQVAESR
Structure information
PDB ID 2ek5 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the transcriptional factor from C.glutamicum at 2.2 angstrom resolution
Assembly ID 4
Resolution 2.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 85
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 3
Chain ID D D
UniProt accession Q8NLJ5 Q8NLJ5
Species 196627 (Corynebacterium glutamicum ATCC 13032) 196627 (Corynebacterium glutamicum ATCC 13032)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2ek5-a4-m1-cD_2ek5-a4-m3-cD.pdb.gz
Full biological assembly
Download: 2ek5-assembly4.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 2ek5/3/2:B/2:A 2du9/1/1:A/2:A 2ek5/1/1:B/1:A 2ek5/2/1:D/1:C 2ek5/3/1:B/1:A 2ek5/4/1:D/1:C 2ek5/4/3:D/3:C
  • [Back to Home]