2eky/1/1:C/1:B

Sequences
>2eky-a1-m1-cC (length=99) [Search sequence]
IFMRKVVAEVSIIPLGKGASVSKYVKKAIEVFKKYDLKVETNAMGTVLEGDLDEILKAFK
EAHSTVLNDVDRVVSSLKIDERKDKENTIERKLKAIGEL
>2eky-a1-m1-cB (length=100) [Search sequence]
MIFMRKVVAEVSIIPLGKGASVSKYVKKAIEVFKKYDLKVETNAMGTVLEGDLDEILKAF
KEAHSTVLNDVDRVVSSLKIDERKDKENTIERKLKAIGEL
Structure information
PDB ID 2eky (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of hypothetical protein MJ1052 from Methanocaldococcus jannaschii (Form 1)
Assembly ID 1
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 37
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C B
UniProt accession Q58452 Q58452
Species 243232 (Methanocaldococcus jannaschii DSM 2661) 243232 (Methanocaldococcus jannaschii DSM 2661)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2eky-a1-m1-cC_2eky-a1-m1-cB.pdb.gz
Full biological assembly
Download: 2eky-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2eky/1/1:A/1:D 2eky/2/1:G/1:F 2eky/2/1:H/1:E 2epi/1/1:B/1:C 2epi/1/1:D/1:A
Other dimers with similar sequences but different poses
  • 2eky/2/1:G/1:H 2eky/1/1:A/1:B 2eky/1/1:D/1:C 2eky/2/1:F/1:E 2epi/1/1:B/1:A 2epi/1/1:C/1:D
  • 2eky/2/1:G/1:E 2eky/1/1:A/1:C 2eky/1/1:D/1:B 2eky/2/1:H/1:F 2epi/1/1:B/1:D 2epi/1/1:C/1:A
  • [Back to Home]