2ere/1/1:A/1:B

Sequences
>2ere-a1-m1-cA (length=60) [Search sequence]
FACVECRQQKSKCDAHPCTKCAKKNVPCILKRDFRRTYKRARNEAIEKRFKELTRTLTNL
>2ere-a1-m1-cB (length=60) [Search sequence]
FACVECRQQKSKCDAHPCTKCAKKNVPCILKRDFRRTYKRARNEAIEKRFKELTRTLTNL
Structure information
PDB ID 2ere (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of a Leu3 DNA-binding domain complexed with a 15mer DNA duplex
Assembly ID 1
Resolution 3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 14
Sequence identity between the two chains 1.0
PubMed citation 16615914
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P08638 P08638
Species 4932 (Saccharomyces cerevisiae) 4932 (Saccharomyces cerevisiae)
Function annotation BioLiP:2ereA BioLiP:2ereB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2ere-a1-m1-cA_2ere-a1-m1-cB.pdb.gz
Full biological assembly
Download: 2ere-assembly1.cif.gz
Similar dimers

[Back to Home]