2esw/3/1:B/1:A

Sequences
>2esw-a3-m1-cB (length=57) [Search sequence]
SQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTHNGRTGWFPSNYVREI
>2esw-a3-m1-cA (length=60) [Search sequence]
PLGSQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTHNGRTGWFPSNYVREI
Structure information
PDB ID 2esw (database links: RCSB PDB PDBe PDBj PDBsum)
Title Atomic structure of the N-terminal SH3 domain of mouse beta PIX,p21-activated kinase (PAK)-interacting exchange factor
Assembly ID 3
Resolution 2.01Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 25
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession Q9ES28 Q9ES28
Species 10090 (Mus musculus) 10090 (Mus musculus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2esw-a3-m1-cB_2esw-a3-m1-cA.pdb.gz
Full biological assembly
Download: 2esw-assembly3.cif.gz

[Back to Home]