2ewc/4/2:D/2:E

Sequences
>2ewc-a4-m2-cD (length=115) [Search sequence]
TIRRYDVNEDRGHTGLVEAGDFYYLNYCVGNVGQDIESQINGAFDEERRLALVGLTLDAV
VQDCLFRDVWNIPVEKIKERFNGRYPARKSIQTEFAHHGGPQGLLFQVDGVAYSK
>2ewc-a4-m2-cE (length=116) [Search sequence]
TIRRYDVNEDRGHTGLVEAGDFYYLNYCVGNVGQDIESQINGAFDEERRLALVGLTLDAV
VQDCLFRDVWNIPVEKIKERFNGRYPARKSIQTEFAHHGGPQGLLFQVDGVAYSKH
Structure information
PDB ID 2ewc (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of hypothetical protein from Streptococcus pyogenes M1 GAS, member of highly conserved yjgF family of proteins
Assembly ID 4
Resolution 2.15Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 73
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID D E
UniProt accession Q99XS4 Q99XS4
Species 160490 (Streptococcus pyogenes M1 GAS) 160490 (Streptococcus pyogenes M1 GAS)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2ewc-a4-m2-cD_2ewc-a4-m2-cE.pdb.gz
Full biological assembly
Download: 2ewc-assembly4.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2ewc/1/1:A/1:B 2ewc/1/1:A/1:C 2ewc/1/1:C/1:B 2ewc/1/1:D/1:E 2ewc/1/1:D/1:F 2ewc/1/1:E/1:F 2ewc/1/1:G/1:K 2ewc/1/1:G/1:L 2ewc/1/1:H/1:I 2ewc/1/1:H/1:J 2ewc/1/1:I/1:J 2ewc/1/1:L/1:K 2ewc/2/1:A/1:B 2ewc/2/1:A/1:C 2ewc/2/1:C/1:B 2ewc/2/1:G/1:K 2ewc/2/1:G/1:L 2ewc/2/1:L/1:K 2ewc/3/1:D/1:E 2ewc/3/1:D/1:F 2ewc/3/1:E/1:F 2ewc/3/1:H/1:I 2ewc/3/1:H/1:J 2ewc/3/1:I/1:J 2ewc/4/1:A/1:B 2ewc/4/1:A/1:C 2ewc/4/1:C/1:B 2ewc/4/2:D/2:F 2ewc/4/2:E/2:F
Other dimers with similar sequences but different poses
  • 2ewc/3/1:J/1:F 2ewc/1/1:A/1:K 2ewc/1/1:C/1:L 2ewc/1/1:D/1:I 2ewc/1/1:E/1:H 2ewc/1/1:G/1:B 2ewc/1/1:J/1:F 2ewc/2/1:A/1:K 2ewc/2/1:C/1:L 2ewc/2/1:G/1:B 2ewc/3/1:D/1:I 2ewc/3/1:E/1:H
  • [Back to Home]