2ezw/1/1:A/1:B

Sequences
>2ezw-a1-m1-cA (length=50) [Search sequence]
SLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFEKLEKEEAK
>2ezw-a1-m1-cB (length=50) [Search sequence]
SLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFEKLEKEEAK
Structure information
PDB ID 2ezw (database links: RCSB PDB PDBe PDBj PDBsum)
Title Solution structure of the docking and dimerization domain of the type I alpha regulatory subunit of protein kinase A (RIalpha D/D)
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 68
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P00514 P00514
Species 9913 (Bos taurus) 9913 (Bos taurus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2ezw-a1-m1-cA_2ezw-a1-m1-cB.pdb.gz
Full biological assembly
Download: 2ezw-assembly1.cif.gz

[Back to Home]