2f8b/1/1:A/1:B

Sequences

>2f8b-a1-m1-cA (length=56) [Search sequence]

GSHMAEPQRHKILCVCCKCDGRIELTVESSAEDLRTLQQLFLSTLSFVCPWCATNQ

>2f8b-a1-m1-cB (length=56) [Search sequence]

GSHMAEPQRHKILCVCCKCDGRIELTVESSAEDLRTLQQLFLSTLSFVCPWCATNQ

Structure information

PDB ID	2f8b (database links: RCSB PDB PDBe PDBj PDBsum)
Title	NMR structure of the C-terminal domain (dimer) of HPV45 oncoprotein E7
Assembly ID	1
Resolution	Not applicable
Method of structure determination	SOLUTION NMR
Number of inter-chain contacts	75
Sequence identity between the two chains	1.0
PubMed citation	16636661

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	P21736	P21736
Species	10593 (human papillomavirus 45)	10593 (human papillomavirus 45)
Function annotation	BioLiP:2f8bA	BioLiP:2f8bB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2f8b-a1-m1-cA_2f8b-a1-m1-cB.pdb.gz

Full biological assembly Download: 2f8b-assembly1.cif.gz