2fb0/1/1:A/2:A

Sequences
>2fb0-a1-m1-cA (length=91) [Search sequence]
ANSIRLNVFVRVNETNREKAIEAAKELTACSLKEEGCIAYDTFESSTRRDVFICETWQNA
EVLAAHEKTAHFAQYVGIIQELAEKLEKFEF
>2fb0-a1-m2-cA (length=91) [Search sequence]
ANSIRLNVFVRVNETNREKAIEAAKELTACSLKEEGCIAYDTFESSTRRDVFICETWQNA
EVLAAHEKTAHFAQYVGIIQELAEKLEKFEF
Structure information
PDB ID 2fb0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of Conserved Protein of Unknown Function from Bacteroides thetaiotaomicron VPI-5482 at 2.10 A Resolution, Possible Oxidoreductase
Assembly ID 1
Resolution 2.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 58
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession Q8A7U6 Q8A7U6
Species 226186 (Bacteroides thetaiotaomicron VPI-5482) 226186 (Bacteroides thetaiotaomicron VPI-5482)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2fb0-a1-m1-cA_2fb0-a1-m2-cA.pdb.gz
Full biological assembly
Download: 2fb0-assembly1.cif.gz

[Back to Home]