2fb6/2/2:A/3:A

Sequences
>2fb6-a2-m2-cA (length=111) [Search sequence]
NASANDKLTILWTTDNKDTVFNLAYALNSKNRGWWKHINIILWGASVKLVANDTQVQTEI
LELQSGITIEACQDCCENFGVASIITNLGITVRYGIPLTEYLKNGEKILSI
>2fb6-a2-m3-cA (length=111) [Search sequence]
NASANDKLTILWTTDNKDTVFNLAYALNSKNRGWWKHINIILWGASVKLVANDTQVQTEI
LELQSGITIEACQDCCENFGVASIITNLGITVRYGIPLTEYLKNGEKILSI
Structure information
PDB ID 2fb6 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of Conserved Protein of Unknown Function BT1422 from Bacteroides thetaiotaomicron
Assembly ID 2
Resolution 1.46Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 44
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 3
Chain ID A A
UniProt accession Q8A7V2 Q8A7V2
Species 226186 (Bacteroides thetaiotaomicron VPI-5482) 226186 (Bacteroides thetaiotaomicron VPI-5482)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2fb6-a2-m2-cA_2fb6-a2-m3-cA.pdb.gz
Full biological assembly
Download: 2fb6-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2fb6/2/1:A/2:A 2fb6/2/1:A/3:A

[Back to Home]