2ffg/1/1:B/1:A

Sequences

>2ffg-a1-m1-cB (length=76) [Search sequence]

SQLGIITRLQSLQETAEAANEPQRYFEVNGEKICSVKYFEKNQTFELTVFQKGEKPNTYP FDNIDVSIEIFELLQL

>2ffg-a1-m1-cA (length=77) [Search sequence]

SQLGIITRLQSLQETAEAANEPQRYFEVNGEKICSVKYFEKNQTFELTVFQKGEKPNTYP FDNIDVSIEIFELLQLE

Structure information

PDB ID	2ffg (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Novel x-ray structure of the YkuJ protein from Bacillus subtilis. Northeast Structural Genomics target SR360.
Assembly ID	1
Resolution	2.31Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	16
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	O34588	O34588
Species	1423 (Bacillus subtilis)	1423 (Bacillus subtilis)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2ffg-a1-m1-cB_2ffg-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2ffg-assembly1.cif.gz