2fka/2/12:A/9:A

Sequences
>2fka-a2-m12-cA (length=128) [Search sequence]
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGFGFIISDWNMP
NMDGLELLKTIRADSAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLN
KIFEKLGM
>2fka-a2-m9-cA (length=128) [Search sequence]
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGFGFIISDWNMP
NMDGLELLKTIRADSAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLN
KIFEKLGM
Structure information
PDB ID 2fka (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of Mg(2+) and BeF(3)(-)-bound CheY in complex with CheZ(200-214) solved from a F432 crystal grown in CAPS (pH 10.5)
Assembly ID 2
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 19
Sequence identity between the two chains 1.0
PubMed citation 16674976
Chain information
Chain 1 Chain 2
Model ID 12 9
Chain ID A A
UniProt accession P0A2D5 P0A2D5
Species 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2)
Function annotation BioLiP:2fkaA BioLiP:2fkaA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2fka-a2-m12-cA_2fka-a2-m9-cA.pdb.gz
Full biological assembly
Download: 2fka-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2fka/2/10:A/4:A 2fka/2/11:A/2:A 2fka/2/1:A/7:A 2fka/2/3:A/6:A 2fka/2/5:A/8:A
Other dimers with similar sequences but different poses
  • 1udr/1/1:C/1:D 1udr/1/1:B/1:A
  • 2flk/2/17:A/9:A 2fka/2/10:A/2:A 2fka/2/10:A/6:A 2fka/2/11:A/9:A 2fka/2/12:A/4:A 2fka/2/12:A/8:A 2fka/2/1:A/11:A 2fka/2/1:A/9:A 2fka/2/2:A/6:A 2fka/2/3:A/5:A 2fka/2/3:A/7:A 2fka/2/4:A/8:A 2fka/2/5:A/7:A 2flk/2/10:A/20:A 2flk/2/10:A/3:A 2flk/2/11:A/18:A 2flk/2/11:A/4:A 2flk/2/12:A/19:A 2flk/2/12:A/2:A 2flk/2/13:A/21:A 2flk/2/13:A/5:A 2flk/2/14:A/23:A 2flk/2/14:A/8:A 2flk/2/15:A/24:A 2flk/2/15:A/6:A 2flk/2/16:A/22:A 2flk/2/16:A/7:A 2flk/2/18:A/4:A 2flk/2/19:A/2:A 2flk/2/1:A/17:A 2flk/2/1:A/9:A 2flk/2/20:A/3:A 2flk/2/21:A/5:A 2flk/2/22:A/7:A 2flk/2/23:A/8:A 2flk/2/24:A/6:A 2fmh/2/10:A/17:A 2fmh/2/10:A/4:A 2fmh/2/11:A/20:A 2fmh/2/12:A/19:A 2fmh/2/12:A/2:A 2fmh/2/13:A/22:A 2fmh/2/13:A/7:A 2fmh/2/14:A/21:A 2fmh/2/14:A/8:A 2fmh/2/15:A/24:A 2fmh/2/15:A/5:A 2fmh/2/16:A/23:A 2fmh/2/16:A/6:A 2fmh/2/17:A/4:A 2fmh/2/18:A/3:A 2fmh/2/18:A/9:A 2fmh/2/19:A/2:A 2fmh/2/1:A/11:A 2fmh/2/1:A/20:A 2fmh/2/21:A/8:A 2fmh/2/22:A/7:A 2fmh/2/23:A/6:A 2fmh/2/24:A/5:A 2fmh/2/3:A/9:A 2fmh/3/11:A/20:A 2fmh/3/1:A/11:A 2fmh/3/1:A/20:A 2fmi/2/1:A/2:A 2fmi/2/1:A/3:A 2fmi/2/2:A/3:A
  • 2fmh/2/21:A/9:A 2flk/2/10:A/21:A 2flk/2/11:A/22:A 2flk/2/12:A/23:A 2flk/2/13:A/4:A 2flk/2/15:A/2:A 2flk/2/16:A/3:A 2flk/2/17:A/5:A 2flk/2/18:A/8:A 2flk/2/19:A/7:A 2flk/2/1:A/14:A 2flk/2/20:A/6:A 2flk/2/24:A/9:A 2fmh/2/10:A/22:A 2fmh/2/11:A/23:A 2fmh/2/12:A/24:A 2fmh/2/14:A/2:A 2fmh/2/15:A/3:A 2fmh/2/16:A/4:A 2fmh/2/17:A/5:A 2fmh/2/18:A/6:A 2fmh/2/19:A/7:A 2fmh/2/1:A/13:A 2fmh/2/20:A/8:A
  • [Back to Home]