2fkd/1/1:C/1:N

Sequences
>2fkd-a1-m1-cC (length=110) [Search sequence]
SDAKRIEGFTLSEEILKSDKQLSVDAQFFTKPLTDGMAIRSEGKIYFVDKQASLSDGLWL
VDIEGAISIRELTKLPGRKLHVAGGKVPFECGIDDIKTLGRVVGVYSEVN
>2fkd-a1-m1-cN (length=110) [Search sequence]
SDAKRIEGFTLSEEILKSDKQLSVDAQFFTKPLTDGMAIRSEGKIYFVDKQASLSDGLWL
VDIEGAISIRELTKLPGRKLHVAGGKVPFECGIDDIKTLGRVVGVYSEVN
Structure information
PDB ID 2fkd (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of the C-terminal domain of Bacteriophage 186 repressor
Assembly ID 1
Resolution 2.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 61
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C N
UniProt accession P08707 P08707
Species 29252 (Eganvirus ev186) 29252 (Eganvirus ev186)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2fkd-a1-m1-cC_2fkd-a1-m1-cN.pdb.gz
Full biological assembly
Download: 2fkd-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2fkd/1/1:A/1:B 2fkd/1/1:D/1:M 2fkd/1/1:E/1:L 2fkd/1/1:F/1:K 2fkd/1/1:G/1:J 2fkd/1/1:H/1:I 7jvt/1/1:C/1:D 7jvt/1/2:C/2:D
Other dimers with similar sequences but different poses
  • 2fkd/1/1:B/1:N 2fkd/1/1:A/1:C 2fkd/1/1:A/1:M 2fkd/1/1:B/1:D 2fkd/1/1:C/1:E 2fkd/1/1:D/1:F 2fkd/1/1:E/1:G 2fkd/1/1:F/1:H 2fkd/1/1:G/1:I 2fkd/1/1:H/1:J 2fkd/1/1:I/1:K 2fkd/1/1:J/1:L 2fkd/1/1:K/1:M 2fkd/1/1:L/1:N 7jvt/1/1:C/2:D 7jvt/1/2:C/1:D
  • [Back to Home]