2fmy/2/1:C/1:D

Sequences

>2fmy-a2-m1-cC (length=218) [Search sequence]

ATQMRLTDTNLLEVLNSEEYSGVLKEFREQRYSKKAILYTPNTERNLVFLVKSGRVRVYL
AYEDKEFTLAILEAGDIFCTHTRAFIQAMEDTTILYTDIRNFQNIVVEFPAFSLNMVKVL
GDLLKNSLTIINGLVFKDARLRLAEFLVQAAMDTGLKVPQGIKLELGLNTEEIALMLGTT
RQTVSVLLNDFKKMGILERVNQRTLLLKDLQKLKEFSS

>2fmy-a2-m1-cD (length=218) [Search sequence]

Structure information

PDB ID	2fmy (database links: RCSB PDB PDBe PDBj PDBsum)
Title	CO-dependent transcription factor CooA from Carboxydothermus hydrogenoformans (Imidazole-bound form)
Assembly ID	2
Resolution	2.2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	83
Sequence identity between the two chains	1.0
PubMed citation	17292914

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	D
UniProt accession	Q3AB29	Q3AB29
Species	129958 (Carboxydothermus hydrogenoformans)	129958 (Carboxydothermus hydrogenoformans)
Function annotation	BioLiP:2fmyC	BioLiP:2fmyD

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	2fmy-a2-m1-cC_2fmy-a2-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	2fmy-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

2fmy/1/1:A/1:B 6cpb/1/1:A/1:B