2fqm/1/1:B/1:A

Sequences

>2fqm-a1-m1-cB (length=63) [Search sequence]

KQPELESDEHGKTLRLTLPEGLSGEQKSQWMLTIKAVVQSAKHWNLAECTFEASGEGVII KKR

>2fqm-a1-m1-cA (length=65) [Search sequence]

DWKQPELESDEHGKTLRLTLPEGLSGEQKSQWMLTIKAVVQSAKHWNLAECTFEASGEGV IIKKR

Structure information

PDB ID	2fqm (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the oligomerization domain of the phosphoprotein of vesicular stomatitis virus
Assembly ID	1
Resolution	2.3Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	143
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	P04880	P04880
Species	11277 (Vesicular stomatitis Indiana virus)	11277 (Vesicular stomatitis Indiana virus)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2fqm-a1-m1-cB_2fqm-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2fqm-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

2fqm/2/1:C/1:D 2fqm/3/1:F/1:E