2fqp/3/2:B/2:A

Sequences
>2fqp-a3-m2-cB (length=90) [Search sequence]
RPGAIPTVQIDNERVKVTEWRFPPGGETGWHRHSDYVVVPTTGPLLLETPEGSVTSQLTR
GVSYTRPEGVEHNVINPSDTEFVFVEIEIK
>2fqp-a3-m2-cA (length=92) [Search sequence]
KRPGAIPTVQIDNERVKVTEWRFPPGGETGWHRHSDYVVVPTTGPLLLETPEGSVTSQLT
RGVSYTRPEGVEHNVINPSDTEFVFVEIEIKA
Structure information
PDB ID 2fqp (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a cupin domain (bp2299) from bordetella pertussis tohama i at 1.80 A resolution
Assembly ID 3
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 56
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID B A
UniProt accession Q7VWF8 Q7VWF8
Species 257313 (Bordetella pertussis Tohama I) 257313 (Bordetella pertussis Tohama I)
Function annotation BioLiP:2fqpB BioLiP:2fqpA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2fqp-a3-m2-cB_2fqp-a3-m2-cA.pdb.gz
Full biological assembly
Download: 2fqp-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2fqp/1/1:B/1:A 2fqp/2/1:D/1:C 2fqp/3/1:D/1:C

[Back to Home]