2g0j/3/3:D/4:D

Sequences
>2g0j-a3-m3-cD (length=113) [Search sequence]
GSMIQATFIRRKGILESVELTGHAGSGEYGFDIVCAAVSTLSMNLVNALEVLADCTVSLQ
MDEFDGGYMKIDLSYITNKSDEKVQLLFEAFLLGITNLAENSPEFVTAKIMTQ
>2g0j-a3-m4-cD (length=113) [Search sequence]
GSMIQATFIRRKGILESVELTGHAGSGEYGFDIVCAAVSTLSMNLVNALEVLADCTVSLQ
MDEFDGGYMKIDLSYITNKSDEKVQLLFEAFLLGITNLAENSPEFVTAKIMTQ
Structure information
PDB ID 2g0j (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of SMU.848 from Streptococcus mutans
Assembly ID 3
Resolution 2.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 28
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 3 4
Chain ID D D
UniProt accession Q8DUQ5 Q8DUQ5
Species 1309 (Streptococcus mutans) 1309 (Streptococcus mutans)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2g0j-a3-m3-cD_2g0j-a3-m4-cD.pdb.gz
Full biological assembly
Download: 2g0j-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 2g0j/3/4:D/4:C 2g0i/1/1:A/1:B 2g0j/1/1:B/1:A 2g0j/2/1:D/1:C 2g0j/3/1:B/1:A 2g0j/3/2:B/2:A 2g0j/3/3:D/3:C
  • 2g0j/3/2:A/4:C 2g0j/3/1:A/3:C
  • 2g0j/3/1:A/4:C 2g0j/3/2:A/3:C
    		•

    [Back to Home]