2g0j/3/4:D/4:C

Sequences

>2g0j-a3-m4-cD (length=113) [Search sequence]

GSMIQATFIRRKGILESVELTGHAGSGEYGFDIVCAAVSTLSMNLVNALEVLADCTVSLQ MDEFDGGYMKIDLSYITNKSDEKVQLLFEAFLLGITNLAENSPEFVTAKIMTQ

>2g0j-a3-m4-cC (length=116) [Search sequence]

MGRGSMIQATFIRRKGILESVELTGHAGSGEYGFDIVCAAVSTLSMNLVNALEVLADCTV SLQMDEFDGGYMKIDLSYITNKSDEKVQLLFEAFLLGITNLAENSPEFVTAKIMTQ

Structure information

PDB ID	2g0j (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of SMU.848 from Streptococcus mutans
Assembly ID	3
Resolution	2.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	77
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	4	4
Chain ID	D	C
UniProt accession	Q8DUQ5	Q8DUQ5
Species	1309 (Streptococcus mutans)	1309 (Streptococcus mutans)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2g0j-a3-m4-cD_2g0j-a3-m4-cC.pdb.gz

Full biological assembly Download: 2g0j-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2g0i/1/1:A/1:B 2g0j/1/1:B/1:A 2g0j/2/1:D/1:C 2g0j/3/1:B/1:A 2g0j/3/2:B/2:A 2g0j/3/3:D/3:C
Other dimers with similar sequences but different poses	2g0j/3/2:A/4:C 2g0j/3/1:A/3:C 2g0j/3/3:D/4:D 2g0j/3/1:B/2:B 2g0j/3/1:A/4:C 2g0j/3/2:A/3:C