2g2p/1/1:A/1:B

Sequences
>2g2p-a1-m1-cA (length=111) [Search sequence]
NILSVHILNQQTGKPAADVTVTLEKKADNGWLQLNTAKTDKDGRIKALWPEQTATTGDYR
VVFKTGDYFKKQNLESFFPEIPVEFHINKVNEHYHVPLLLSQYGYSTYRGS
>2g2p-a1-m1-cB (length=111) [Search sequence]
NILSVHILNQQTGKPAADVTVTLEKKADNGWLQLNTAKTDKDGRIKALWPEQTATTGDYR
VVFKTGDYFKKQNLESFFPEIPVEFHINKVNEHYHVPLLLSQYGYSTYRGS
Structure information
PDB ID 2g2p (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of E.coli transthyretin-related protein with bound Zn and Br
Assembly ID 1
Resolution 2.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 56
Sequence identity between the two chains 1.0
PubMed citation 16723258
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P76341 P76341
Species 562 (Escherichia coli) 562 (Escherichia coli)
Function annotation BioLiP:2g2pA BioLiP:2g2pB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2g2p-a1-m1-cA_2g2p-a1-m1-cB.pdb.gz
Full biological assembly
Download: 2g2p-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2g2n/1/1:A/1:B 2g2n/1/1:C/1:D 2g2n/2/1:A/1:B 2g2n/2/2:C/2:D 2g2p/1/1:C/1:D 2igl/1/1:A/1:B 2igl/1/1:C/1:D
Other dimers with similar sequences but different poses
  • 2g2n/1/1:A/1:D 2g2n/1/1:B/1:C 2g2p/1/1:A/1:D 2g2p/1/1:B/1:C 2igl/1/1:A/1:C 2igl/1/1:B/1:D
  • 2g2n/1/1:A/1:C 2g2n/1/1:B/1:D 2g2p/1/1:A/1:C 2g2p/1/1:B/1:D 2igl/1/1:A/1:D 2igl/1/1:B/1:C
  • [Back to Home]