2g2q/4/2:C/1:A

Sequences
>2g2q-a4-m2-cC (length=107) [Search sequence]
KNVLIIFGKPYCSICENVSDAVEELKSEYDILHVDILSFFLKDGTLIGNFAAHLSNYIVS
IFKYNPQTKQAFVDINKSLDFTKTDKSLVNLEILKSEIEKATYGVWP
>2g2q-a4-m1-cA (length=112) [Search sequence]
KNVLIIFGKPYCSICENVSDAVEELKSEYDILHVDILSFFLKDGDSSRGTLIGNFAAHLS
NYIVSIFKYNPQTKQAFVDINKSLDFTKTDKSLVNLEILKSEIEKATYGVWP
Structure information
PDB ID 2g2q (database links: RCSB PDB PDBe PDBj PDBsum)
Title The crystal structure of G4, the poxviral disulfide oxidoreductase essential for cytoplasmic disulfide bond formation
Assembly ID 4
Resolution 2.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 33
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 1
Chain ID C A
UniProt accession P68460 P68460
Species 10245 (Vaccinia virus) 10245 (Vaccinia virus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2g2q-a4-m2-cC_2g2q-a4-m1-cA.pdb.gz
Full biological assembly
Download: 2g2q-assembly4.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2g2q/4/1:B/2:B 2g2q/4/1:C/2:A
Other dimers with similar sequences but different poses
  • 2g2q/5/1:A/2:B 2g2q/4/1:A/2:B 2g2q/4/1:C/2:C 2g2q/4/2:A/1:B 2g2q/6/1:C/2:C
    		•

    [Back to Home]