2g2q/5/1:A/2:B

Sequences

>2g2q-a5-m1-cA (length=112) [Search sequence]

KNVLIIFGKPYCSICENVSDAVEELKSEYDILHVDILSFFLKDGDSSRGTLIGNFAAHLS NYIVSIFKYNPQTKQAFVDINKSLDFTKTDKSLVNLEILKSEIEKATYGVWP

>2g2q-a5-m2-cB (length=118) [Search sequence]

KNVLIIFGKPYCSICENVSDAVEELKSEYDILHVDILSFFLKDGDSSLGDVKRGTLIGNF AAHLSNYIVSIFKYNPQTKQAFVDINKSLDFTKTDKSLVNLEILKSEIEKATYGVWPP

Structure information

PDB ID	2g2q (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The crystal structure of G4, the poxviral disulfide oxidoreductase essential for cytoplasmic disulfide bond formation
Assembly ID	5
Resolution	2.5Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	125
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	2
Chain ID	A	B
UniProt accession	P68460	P68460
Species	10245 (Vaccinia virus)	10245 (Vaccinia virus)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2g2q-a5-m1-cA_2g2q-a5-m2-cB.pdb.gz

Full biological assembly Download: 2g2q-assembly5.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2g2q/4/1:A/2:B 2g2q/4/1:C/2:C 2g2q/4/2:A/1:B 2g2q/6/1:C/2:C
Other dimers with similar sequences but different poses	2g2q/4/2:C/1:A 2g2q/4/1:B/2:B 2g2q/4/1:C/2:A