2g3k/9/1:A/1:F

Sequences

>2g3k-a9-m1-cA (length=93) [Search sequence]

FNAKYVAEATGNFITVDALKLNYNAKDQLHPLLAELLISINRVTRDDFENRSKLIDWIVR INKLSIGDTLTETQIRELLFDLELAYKSFYALL

>2g3k-a9-m1-cF (length=93) [Search sequence]

FNAKYVAEATGNFITVDALKLNYNAKDQLHPLLAELLISINRVTRDDFENRSKLIDWIVR INKLSIGDTLTETQIRELLFDLELAYKSFYALL

Structure information

PDB ID	2g3k (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the C-terminal domain of Vps28
Assembly ID	9
Resolution	3.05Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	39
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	F
UniProt accession	Q02767	Q02767
Species	4932 (Saccharomyces cerevisiae)	4932 (Saccharomyces cerevisiae)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2g3k-a9-m1-cA_2g3k-a9-m1-cF.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2g3k-assembly9.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2g3k/10/1:C/2:G 2g3k/11/1:A/1:F
Other dimers with similar sequences but different poses	2g3k/9/1:A/1:B 2g3k/8/1:A/1:B