2g3k/9/1:A/1:F

Sequences
>2g3k-a9-m1-cA (length=93) [Search sequence]
FNAKYVAEATGNFITVDALKLNYNAKDQLHPLLAELLISINRVTRDDFENRSKLIDWIVR
INKLSIGDTLTETQIRELLFDLELAYKSFYALL
>2g3k-a9-m1-cF (length=93) [Search sequence]
FNAKYVAEATGNFITVDALKLNYNAKDQLHPLLAELLISINRVTRDDFENRSKLIDWIVR
INKLSIGDTLTETQIRELLFDLELAYKSFYALL
Structure information
PDB ID 2g3k (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the C-terminal domain of Vps28
Assembly ID 9
Resolution 3.05Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 39
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A F
UniProt accession Q02767 Q02767
Species 4932 (Saccharomyces cerevisiae) 4932 (Saccharomyces cerevisiae)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2g3k-a9-m1-cA_2g3k-a9-m1-cF.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2g3k-assembly9.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2g3k/10/1:C/2:G 2g3k/11/1:A/1:F
Other dimers with similar sequences but different poses
  • 2g3k/9/1:A/1:B 2g3k/8/1:A/1:B
  • [Back to Home]