2g9e/1/2:A/4:A

Sequences
>2g9e-a1-m2-cA (length=68) [Search sequence]
AFNQTEFNKLLLECVVKTQSSVAKILGILSLSPHVSGNSKFEYANMVEDIREKVSSEMER
FFPKNDDE
>2g9e-a1-m4-cA (length=68) [Search sequence]
AFNQTEFNKLLLECVVKTQSSVAKILGILSLSPHVSGNSKFEYANMVEDIREKVSSEMER
FFPKNDDE
Structure information
PDB ID 2g9e (database links: RCSB PDB PDBe PDBj PDBsum)
Title Protonation-mediated structural flexibility in the F conjugation regulatory protein, TRAM
Assembly ID 1
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 75
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 4
Chain ID A A
UniProt accession P10026 P10026
Species 562 (Escherichia coli) 562 (Escherichia coli)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2g9e-a1-m2-cA_2g9e-a1-m4-cA.pdb.gz
Full biological assembly
Download: 2g9e-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2g7o/1/1:A/3:A 2g7o/1/1:A/4:A 2g7o/1/2:A/3:A 2g7o/1/2:A/4:A 2g9e/1/1:A/3:A 2g9e/1/1:A/4:A 2g9e/1/2:A/3:A 3d8a/1/1:E/1:G 3d8a/1/1:E/1:H 3d8a/1/1:F/1:G 3d8a/1/1:F/1:H 3d8a/2/1:A/1:C 3d8a/2/1:A/1:D 3d8a/2/1:B/1:C 3d8a/2/1:B/1:D
Other dimers with similar sequences but different poses
  • 2g9e/1/3:A/4:A 2g7o/1/1:A/2:A 2g7o/1/3:A/4:A 2g9e/1/1:A/2:A 3d8a/1/1:E/1:F 3d8a/1/1:G/1:H 3d8a/2/1:A/1:B 3d8a/2/1:C/1:D
  • [Back to Home]