2g9j/1/1:A/1:B

Sequences
>2g9j-a1-m1-cA (length=33) [Search sequence]
GMDAIKKKMQMLKLDNYHLENEVARLKKLVGER
>2g9j-a1-m1-cB (length=33) [Search sequence]
GMDAIKKKMQMLKLDNYHLENEVARLKKLVGER
Structure information
PDB ID 2g9j (database links: RCSB PDB PDBe PDBj PDBsum)
Title Complex of TM1a(1-14)Zip with TM9a(251-284): a model for the polymerization domain (""overlap region"") of tropomyosin, Northeast Structural Genomics Target OR9
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 28
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P03069 P03069
Species 559292 (Saccharomyces cerevisiae S288C) 559292 (Saccharomyces cerevisiae S288C)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2g9j-a1-m1-cA_2g9j-a1-m1-cB.pdb.gz
Full biological assembly
Download: 2g9j-assembly1.cif.gz

[Back to Home]