2gbo/2/1:B/2:B

Sequences
>2gbo-a2-m1-cB (length=79) [Search sequence]
DEGISKKFAIQLLEDDAERIKLIRNQKNSLCISQCKAFEEVVDTQYGFSRQVTYATRLGI
LTNDEGHRLLSDLERELNQ
>2gbo-a2-m2-cB (length=79) [Search sequence]
DEGISKKFAIQLLEDDAERIKLIRNQKNSLCISQCKAFEEVVDTQYGFSRQVTYATRLGI
LTNDEGHRLLSDLERELNQ
Structure information
PDB ID 2gbo (database links: RCSB PDB PDBe PDBj PDBsum)
Title Protein of Unknown Function EF2458 from Enterococcus faecalis
Assembly ID 2
Resolution 2.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 30
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID B B
UniProt accession Q831P3 Q831P3
Species 226185 (Enterococcus faecalis V583) 226185 (Enterococcus faecalis V583)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2gbo-a2-m1-cB_2gbo-a2-m2-cB.pdb.gz
Full biological assembly
Download: 2gbo-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 2gbo/2/2:A/2:B 2gbo/1/1:A/1:B 2gbo/2/1:A/1:B
  • 2gbo/2/1:A/2:B 2gbo/2/1:B/2:A
  • [Back to Home]