2gf4/1/1:B/2:B

Sequences
>2gf4-a1-m1-cB (length=72) [Search sequence]
HKDELLELHEQVNIKDQFLGFDHVDETAFAAYEELDVEPSHVHKSKSEHKHAVFLLGNAL
AAASEDEFSSAG
>2gf4-a1-m2-cB (length=72) [Search sequence]
HKDELLELHEQVNIKDQFLGFDHVDETAFAAYEELDVEPSHVHKSKSEHKHAVFLLGNAL
AAASEDEFSSAG
Structure information
PDB ID 2gf4 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of Vng1086c from Halobacterium salinarium (Halobacterium halobium). Northeast Structural Genomics Target HsR14
Assembly ID 1
Resolution 2.07Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 64
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID B B
UniProt accession Q9HQM9 Q9HQM9
Species 64091 (Halobacterium salinarum NRC-1) 64091 (Halobacterium salinarum NRC-1)
Function annotation BioLiP:2gf4B BioLiP:2gf4B
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2gf4-a1-m1-cB_2gf4-a1-m2-cB.pdb.gz
Full biological assembly
Download: 2gf4-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 2gf4/1/2:B/2:A 2gf4/1/1:B/1:A
  • 2gf4/1/2:B/1:A 2gf4/1/1:B/2:A
  • [Back to Home]