2gf4/1/2:B/1:A

Sequences

>2gf4-a1-m2-cB (length=72) [Search sequence]

HKDELLELHEQVNIKDQFLGFDHVDETAFAAYEELDVEPSHVHKSKSEHKHAVFLLGNAL AAASEDEFSSAG

>2gf4-a1-m1-cA (length=85) [Search sequence]

HKDELLELHEQVNIKDQFLGFDHVDETAFAAYEELDVEPSHVHKSKSEHKHAVFLLGNAL AAASEDEFSSAGRISKREELADDAS

Structure information

PDB ID	2gf4 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of Vng1086c from Halobacterium salinarium (Halobacterium halobium). Northeast Structural Genomics Target HsR14
Assembly ID	1
Resolution	2.07Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	16
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	2	1
Chain ID	B	A
UniProt accession	Q9HQM9	Q9HQM9
Species	64091 (Halobacterium salinarum NRC-1)	64091 (Halobacterium salinarum NRC-1)
Function annotation	BioLiP:2gf4B	BioLiP:2gf4A

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2gf4-a1-m2-cB_2gf4-a1-m1-cA.pdb.gz

Full biological assembly Download: 2gf4-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

2gf4/1/1:B/2:B 2gf4/1/1:A/2:A 2gf4/1/2:B/2:A 2gf4/1/1:B/1:A