2ghj/3/1:A/1:D

Sequences

>2ghj-a3-m1-cA (length=99) [Search sequence]

LAKGYRGQRSRSYRRAKEAVRALYYQYRDRKLRKREFRRLWIARINAAVRAYGLNYSTFI NGLKKAGIELDRKILADAVRDPQAFEQVVNKVKEALQVQ

>2ghj-a3-m1-cD (length=99) [Search sequence]

LAKGYRGQRSRSYRRAKEAVRALYYQYRDRKLRKREFRRLWIARINAAVRAYGLNYSTFI NGLKKAGIELDRKILADAVRDPQAFEQVVNKVKEALQVQ

Structure information

PDB ID	2ghj (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of folded and partially unfolded forms of Aquifex aeolicus ribosomal protein L20
Assembly ID	3
Resolution	2.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	85
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	D
UniProt accession	O67086	O67086
Species	63363 (Aquifex aeolicus)	63363 (Aquifex aeolicus)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2ghj-a3-m1-cA_2ghj-a3-m1-cD.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2ghj-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

2ghj/3/1:B/1:E 2ghj/2/1:B/1:E 2ghj/5/1:E/1:A 2ghj/3/1:B/1:D 2ghj/3/1:E/1:A 2ghj/4/1:B/1:D