2ghj/3/1:B/1:E

Sequences
>2ghj-a3-m1-cB (length=90) [Search sequence]
SRSYRRAKEAVRALYYQYRDRKLRKREFRRLWIARINAAVRAYGLNYSTFINGLKKAGIE
LDRKILADAVRDPQAFEQVVNKVKEALQVQ
>2ghj-a3-m1-cE (length=90) [Search sequence]
SRSYRRAKEAVRALYYQYRDRKLRKREFRRLWIARINAAVRAYGLNYSTFINGLKKAGIE
LDRKILADAVRDPQAFEQVVNKVKEALQVQ
Structure information
PDB ID 2ghj (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of folded and partially unfolded forms of Aquifex aeolicus ribosomal protein L20
Assembly ID 3
Resolution 2.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 103
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B E
UniProt accession O67086 O67086
Species 63363 (Aquifex aeolicus) 63363 (Aquifex aeolicus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2ghj-a3-m1-cB_2ghj-a3-m1-cE.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2ghj-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 2ghj/3/1:A/1:D 2ghj/1/1:A/1:D
  • 2ghj/5/1:E/1:A 2ghj/3/1:B/1:D 2ghj/3/1:E/1:A 2ghj/4/1:B/1:D
  • [Back to Home]