2ghj/5/1:E/1:A

Sequences
>2ghj-a5-m1-cE (length=90) [Search sequence]
SRSYRRAKEAVRALYYQYRDRKLRKREFRRLWIARINAAVRAYGLNYSTFINGLKKAGIE
LDRKILADAVRDPQAFEQVVNKVKEALQVQ
>2ghj-a5-m1-cA (length=99) [Search sequence]
LAKGYRGQRSRSYRRAKEAVRALYYQYRDRKLRKREFRRLWIARINAAVRAYGLNYSTFI
NGLKKAGIELDRKILADAVRDPQAFEQVVNKVKEALQVQ
Structure information
PDB ID 2ghj (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of folded and partially unfolded forms of Aquifex aeolicus ribosomal protein L20
Assembly ID 5
Resolution 2.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 14
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID E A
UniProt accession O67086 O67086
Species 63363 (Aquifex aeolicus) 63363 (Aquifex aeolicus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2ghj-a5-m1-cE_2ghj-a5-m1-cA.pdb.gz
Full biological assembly
Download: 2ghj-assembly5.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2ghj/3/1:B/1:D 2ghj/3/1:E/1:A 2ghj/4/1:B/1:D
Other dimers with similar sequences but different poses
  • 2ghj/3/1:A/1:D 2ghj/1/1:A/1:D
  • 2ghj/3/1:B/1:E 2ghj/2/1:B/1:E
  • [Back to Home]