2gj2/3/1:A/3:D

Sequences
>2gj2-a3-m1-cA (length=79) [Search sequence]
ATFQTDADFLLVGDDTSRYEEVMKTFDTVEAVRKSDLDDRVYMVCLKQGSTFVLNGGIEE
LRLLTGDSTLEIQPMIVPT
>2gj2-a3-m3-cD (length=79) [Search sequence]
ATFQTDADFLLVGDDTSRYEEVMKTFDTVEAVRKSDLDDRVYMVCLKQGSTFVLNGGIEE
LRLLTGDSTLEIQPMIVPT
Structure information
PDB ID 2gj2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of VP9 from White Spot Syndrome Virus
Assembly ID 3
Resolution 2.35Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 17
Sequence identity between the two chains 1.0
PubMed citation 16956937
Chain information
Chain 1 Chain 2
Model ID 1 3
Chain ID A D
UniProt accession Q91LD0 Q91LD0
Species 92652 (Shrimp white spot syndrome virus) 92652 (Shrimp white spot syndrome virus)
Function annotation BioLiP:2gj2A BioLiP:2gj2D
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2gj2-a3-m1-cA_2gj2-a3-m3-cD.pdb.gz
Full biological assembly
Download: 2gj2-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 2gj2/2/1:B/1:C 2gj2/1/1:A/1:D
  • 2gj2/5/1:D/5:B 2gj2/3/1:A/2:C 2gj2/3/1:B/3:D 2gj2/4/1:C/4:A
  • [Back to Home]