2gj2/5/1:D/5:B

Sequences

>2gj2-a5-m1-cD (length=79) [Search sequence]

ATFQTDADFLLVGDDTSRYEEVMKTFDTVEAVRKSDLDDRVYMVCLKQGSTFVLNGGIEE LRLLTGDSTLEIQPMIVPT

>2gj2-a5-m5-cB (length=79) [Search sequence]

ATFQTDADFLLVGDDTSRYEEVMKTFDTVEAVRKSDLDDRVYMVCLKQGSTFVLNGGIEE LRLLTGDSTLEIQPMIVPT

Structure information

PDB ID	2gj2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of VP9 from White Spot Syndrome Virus
Assembly ID	5
Resolution	2.35Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	52
Sequence identity between the two chains	1.0
PubMed citation	16956937

Chain information

	Chain 1	Chain 2
Model ID	1	5
Chain ID	D	B
UniProt accession	Q91LD0	Q91LD0
Species	92652 (Shrimp white spot syndrome virus)	92652 (Shrimp white spot syndrome virus)
Function annotation	BioLiP:2gj2D	BioLiP:2gj2B

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2gj2-a5-m1-cD_2gj2-a5-m5-cB.pdb.gz

Full biological assembly Download: 2gj2-assembly5.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2gj2/3/1:A/2:C 2gj2/3/1:B/3:D 2gj2/4/1:C/4:A
Other dimers with similar sequences but different poses	2gj2/2/1:B/1:C 2gj2/1/1:A/1:D 2gj2/3/1:A/3:D 2gj2/3/1:B/2:C