2gj3/4/2:B/3:B

Sequences
>2gj3-a4-m2-cB (length=119) [Search sequence]
ELLPEIFRQTVEHAPIAISITDLKANILYANRAFRTITGYGSEEVLGKNESILSNGTTPR
LVYQALWGRLAQKKPWSGVLVNRRKDKTLYLAELTVAPVLNEAGETIYYLGMHRDTSEL
>2gj3-a4-m3-cB (length=119) [Search sequence]
ELLPEIFRQTVEHAPIAISITDLKANILYANRAFRTITGYGSEEVLGKNESILSNGTTPR
LVYQALWGRLAQKKPWSGVLVNRRKDKTLYLAELTVAPVLNEAGETIYYLGMHRDTSEL
Structure information
PDB ID 2gj3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the FAD-containing PAS domain of the protein NifL from Azotobacter vinelandii.
Assembly ID 4
Resolution 1.04Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 10
Sequence identity between the two chains 1.0
PubMed citation 17319691
Chain information
Chain 1 Chain 2
Model ID 2 3
Chain ID B B
UniProt accession P30663 P30663
Species 354 (Azotobacter vinelandii) 354 (Azotobacter vinelandii)
Function annotation BioLiP:2gj3B BioLiP:2gj3B
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2gj3-a4-m2-cB_2gj3-a4-m3-cB.pdb.gz
Full biological assembly
Download: 2gj3-assembly4.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2gj3/2/1:B/2:B 2gj3/2/1:B/3:B 2gj3/2/2:B/3:B 2gj3/2/4:B/5:B 2gj3/2/4:B/6:B 2gj3/2/5:B/6:B 2gj3/4/1:B/2:B 2gj3/4/1:B/3:B
Other dimers with similar sequences but different poses
  • 2gj3/6/9:A/9:B 2gj3/1/1:A/1:B 2gj3/2/1:A/1:B 2gj3/2/2:A/2:B 2gj3/2/3:A/3:B 2gj3/2/4:A/4:B 2gj3/2/5:A/5:B 2gj3/2/6:A/6:B 2gj3/3/1:A/1:B 2gj3/3/7:A/7:B 2gj3/3/8:A/8:B 2gj3/4/1:A/1:B 2gj3/4/2:A/2:B 2gj3/4/3:A/3:B 2gj3/5/1:A/1:B 2gj3/5/6:A/6:B 2gj3/6/1:A/1:B
  • 2gj3/5/1:A/6:A 2gj3/2/1:A/6:A 2gj3/2/2:A/5:A 2gj3/2/3:A/4:A
  • 2gj3/3/7:B/8:B 2gj3/3/1:A/7:A 2gj3/3/1:A/8:A 2gj3/3/1:B/7:B 2gj3/3/1:B/8:B 2gj3/3/7:A/8:A
    		•

    [Back to Home]