2gk2/4/3:A/3:B

Sequences
>2gk2-a4-m3-cA (length=109) [Search sequence]
GAQLTTESMPFNVAEGKEVLLLVHNLPQQLFGYSWYKGERVDGNRQIVGYAIGTQQATPG
PANSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVY
>2gk2-a4-m3-cB (length=111) [Search sequence]
SGGAQLTTESMPFNVAEGKEVLLLVHNLPQQLFGYSWYKGERVDGNRQIVGYAIGTQQAT
PGPANSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVY
Structure information
PDB ID 2gk2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the N terminal domain of human CEACAM1
Assembly ID 4
Resolution 2.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 24
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 3 3
Chain ID A B
UniProt accession P13688 P13688
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2gk2-a4-m3-cA_2gk2-a4-m3-cB.pdb.gz
Full biological assembly
Download: 2gk2-assembly4.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2gk2/4/1:A/1:B 2gk2/4/2:A/2:B
Other dimers with similar sequences but different poses
  • 2gk2/4/2:A/3:A 2gk2/3/1:A/2:A 2gk2/3/1:A/3:A 2gk2/3/2:A/3:A 2gk2/4/1:A/2:A 2gk2/4/1:A/3:A
  • 2gk2/5/1:A/5:B 2gk2/3/1:A/5:B 2gk2/3/2:A/6:B 2gk2/3/3:A/4:B 4qxw/1/1:A/1:B 4whd/1/1:A/1:B 5dzl/1/1:A/1:B 5dzl/2/1:C/1:D 6xno/1/1:A/1:B 6xnt/1/1:A/1:B 6xnw/1/1:A/1:B 6xnw/2/1:C/1:D 7mu8/1/1:A/1:B 7rpp/1/1:A/2:A 7rpp/2/1:B/1:C
  • [Back to Home]