2gk2/5/1:A/5:B

Sequences

>2gk2-a5-m1-cA (length=109) [Search sequence]

GAQLTTESMPFNVAEGKEVLLLVHNLPQQLFGYSWYKGERVDGNRQIVGYAIGTQQATPG PANSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVY

>2gk2-a5-m5-cB (length=111) [Search sequence]

SGGAQLTTESMPFNVAEGKEVLLLVHNLPQQLFGYSWYKGERVDGNRQIVGYAIGTQQAT PGPANSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVY

Structure information

PDB ID	2gk2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the N terminal domain of human CEACAM1
Assembly ID	5
Resolution	2.2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	77
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	5
Chain ID	A	B
UniProt accession	P13688	P13688
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2gk2-a5-m1-cA_2gk2-a5-m5-cB.pdb.gz

Full biological assembly Download: 2gk2-assembly5.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2gk2/3/1:A/5:B 2gk2/3/2:A/6:B 2gk2/3/3:A/4:B 4qxw/1/1:A/1:B 4whd/1/1:A/1:B 5dzl/1/1:A/1:B 5dzl/2/1:C/1:D 6xno/1/1:A/1:B 6xnt/1/1:A/1:B 6xnw/1/1:A/1:B 6xnw/2/1:C/1:D 7mu8/1/1:A/1:B 7rpp/1/1:A/2:A 7rpp/2/1:B/1:C
Other dimers with similar sequences but different poses	2gk2/4/2:A/3:A 2gk2/3/1:A/2:A 2gk2/3/1:A/3:A 2gk2/3/2:A/3:A 2gk2/4/1:A/2:A 2gk2/4/1:A/3:A 2gk2/4/3:A/3:B 2gk2/4/1:A/1:B 2gk2/4/2:A/2:B