2gm3/2/1:C/1:D

Sequences
>2gm3-a2-m1-cC (length=150) [Search sequence]
PTKVVAVNASTIKDYPNPSISCKRAFEWTLEKIVRSNTSDFKILLLHVQVSIYASPEDFR
DRQSNKAKGLHLLEFFVNKCHEIGVGCEAWIKTGDPKDVICQEVKRVRPDFLVVGSRGLG
TVSAFCVKHAECPVTIKRNADETPSDPADD
>2gm3-a2-m1-cD (length=150) [Search sequence]
PTKVVAVNASTIKDYPNPSISCKRAFEWTLEKIVRSNTSDFKILLLHVQVSIYASPEDFR
DRQSNKAKGLHLLEFFVNKCHEIGVGCEAWIKTGDPKDVICQEVKRVRPDFLVVGSRGLG
TVSAFCVKHAECPVTIKRNADETPSDPADD
Structure information
PDB ID 2gm3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of an Universal Stress Protein Family Protein from Arabidopsis Thaliana At3g01520 with AMP Bound
Assembly ID 2
Resolution 2.461Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 46
Sequence identity between the two chains 1.0
PubMed citation 25921306
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession Q8LGG8 Q8LGG8
Species 3702 (Arabidopsis thaliana) 3702 (Arabidopsis thaliana)
Function annotation BioLiP:2gm3C BioLiP:2gm3D
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2gm3-a2-m1-cC_2gm3-a2-m1-cD.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2gm3-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2gm3/1/1:B/1:A 2gm3/3/1:F/1:E
Other dimers with similar sequences but different poses
  • 2gm3/4/1:C/1:E 2gm3/5/1:A/2:D 2gm3/6/1:B/3:F
    		•

    [Back to Home]