2gmq/1/2:A/2:B

Sequences
>2gmq-a1-m2-cA (length=96) [Search sequence]
GKEIAIQEKDLTLQWRGNTGKLVKVRLKNTRAEWYNKQITEENIQEITTLNIIKNGKSLA
LEVYPEKSIYVKPRINVPVFFIKTPINRGVFEEIFG
>2gmq-a1-m2-cB (length=96) [Search sequence]
KEIAIQEKDLTLQWRGNTGKLVKVRLKNTRAEWYNKQITEENIQEITTLNIIKNGKSLAL
EVYPEKSIYVKPGRINVPVFFIKTPINRGVFEEIFG
Structure information
PDB ID 2gmq (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of protein EF0006 from Enterococcus faecalis
Assembly ID 1
Resolution 1.76Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 22
Sequence identity between the two chains 0.99
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID A B
UniProt accession Q8KUD5 Q8KUD5
Species 1351 (Enterococcus faecalis) 1351 (Enterococcus faecalis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2gmq-a1-m2-cA_2gmq-a1-m2-cB.pdb.gz
Full biological assembly
Download: 2gmq-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 2gmq/1/1:B/2:B 2gmq/1/1:A/2:A
  • [Back to Home]