2goy/2/1:F/1:H

Sequences

>2goy-a2-m1-cF (length=223) [Search sequence]

PFDLPALASSLADKSPQDILKAAFEHFGDELWISFSGAEDVVLVDMAWKLNRNVKVFSLD
TGRLHPETYRFIDQVREHYGIAIDVLSPDPRLLEPLVKEKGLFSFYRDGHGECCGIRKIE
PLKRKLAGVRAWATGQRRDQSPGTRSQVAVLEIDGAFSTPEKPLYKFNPLSSMTSEEVWG
YIRMLELPYNSLHERGYISIGCEPCTRPVLPNQHEREGRWWWE

>2goy-a2-m1-cH (length=223) [Search sequence]

Structure information

PDB ID	2goy (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of assimilatory adenosine 5'-phosphosulfate reductase with bound APS
Assembly ID	2
Resolution	2.7Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	85
Sequence identity between the two chains	1.0
PubMed citation	17010373

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	F	H
UniProt accession	O05927	O05927
Species	287 (Pseudomonas aeruginosa)	287 (Pseudomonas aeruginosa)
Function annotation	BioLiP:2goyF	BioLiP:2goyH

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	2goy-a2-m1-cF_2goy-a2-m1-cH.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	2goy-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2goy/1/1:A/1:C 2goy/1/1:B/1:D 2goy/2/1:E/1:G
Other dimers with similar sequences but different poses	2goy/2/1:G/1:H 2goy/1/1:A/1:B 2goy/1/1:C/1:D 2goy/2/1:E/1:F