2gsr/1/1:A/1:B

Sequences

>2gsr-a1-m1-cA (length=207) [Search sequence]

PPYTITYFPVRGRCEAMRMLLADQDQSWKEEVVTMETWPPLKPSCLFRQLPKFQDGDLTL
YQSNAILRHLGRSFGLYGKDQKEAALVDMVNDGVEDLRCKYATLIYTNYEAGKEKYVKEL
PEHLKPFETLLSQNQGGQAFVVGSQISFADYNLLDLLRIHQVLNPSCLDAFPLLSAYVAR
LSARPKIKAFLASPEHVNRPINGNGKQ

>2gsr-a1-m1-cB (length=207) [Search sequence]

Structure information

PDB ID	2gsr (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of porcine class pi glutathione s-transferase
Assembly ID	1
Resolution	2.11Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	74
Sequence identity between the two chains	1.0
PubMed citation	7932743

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	P80031	P80031
Species	9823 (Sus scrofa)	9823 (Sus scrofa)
Function annotation	BioLiP:2gsrA	BioLiP:2gsrB

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	2gsr-a1-m1-cA_2gsr-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	2gsr-assembly1.cif.gz