2gsv/3/1:A/2:A

Sequences
>2gsv-a3-m1-cA (length=65) [Search sequence]
ELFSVPYFIENLKQHIENQSEDKIHANSYYRSVVSTLVQDQLTKNAVVLKRIQHLDEAYN
KVKRG
>2gsv-a3-m2-cA (length=65) [Search sequence]
ELFSVPYFIENLKQHIENQSEDKIHANSYYRSVVSTLVQDQLTKNAVVLKRIQHLDEAYN
KVKRG
Structure information
PDB ID 2gsv (database links: RCSB PDB PDBe PDBj PDBsum)
Title X-Ray Crystal Structure of Protein YvfG from Bacillus subtilis. Northeast Structural Genomics Consortium Target SR478.
Assembly ID 3
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 14
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession P71066 P71066
Species 1423 (Bacillus subtilis) 1423 (Bacillus subtilis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2gsv-a3-m1-cA_2gsv-a3-m2-cA.pdb.gz
Full biological assembly
Download: 2gsv-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 2gsv/2/2:A/2:B 2gsv/1/1:A/1:B 2gsv/2/1:A/1:B
  • 2gsv/3/2:A/4:B 2gsv/3/1:A/3:B
  • [Back to Home]