2gta/1/1:C/1:A

Sequences

>2gta-a1-m1-cC (length=81) [Search sequence]

SDKTKDIQAEVDRYIGQFKEGYFSPLAARLTEELGELAREVNHRYSEEEIGDVLFVLVCL ANSLDISLEEAHDRVHKFNTR

>2gta-a1-m1-cA (length=92) [Search sequence]

SDKTKDIQAEVDRYIGQFKEGYFSPLAARLTEELGELAREVNHRYGEKPKKATEDDKSEE EIGDVLFVLVCLANSLDISLEEAHDRVHKFNT

Structure information

PDB ID	2gta (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of the putative pyrophosphatase YPJD from Bacillus subtilis. Northeast Structural Genomics Consortium Target SR428.
Assembly ID	1
Resolution	2.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	43
Sequence identity between the two chains	0.988

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	A
UniProt accession	P42979	P42979
Species	1423 (Bacillus subtilis)	1423 (Bacillus subtilis)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2gta-a1-m1-cC_2gta-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2gta-assembly1.cif.gz