2gta/1/1:C/1:A

Sequences
>2gta-a1-m1-cC (length=81) [Search sequence]
SDKTKDIQAEVDRYIGQFKEGYFSPLAARLTEELGELAREVNHRYSEEEIGDVLFVLVCL
ANSLDISLEEAHDRVHKFNTR
>2gta-a1-m1-cA (length=92) [Search sequence]
SDKTKDIQAEVDRYIGQFKEGYFSPLAARLTEELGELAREVNHRYGEKPKKATEDDKSEE
EIGDVLFVLVCLANSLDISLEEAHDRVHKFNT
Structure information
PDB ID 2gta (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of the putative pyrophosphatase YPJD from Bacillus subtilis. Northeast Structural Genomics Consortium Target SR428.
Assembly ID 1
Resolution 2.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 43
Sequence identity between the two chains 0.988
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C A
UniProt accession P42979 P42979
Species 1423 (Bacillus subtilis) 1423 (Bacillus subtilis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2gta-a1-m1-cC_2gta-a1-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2gta-assembly1.cif.gz

[Back to Home]