2gtc/1/1:D/1:E

Sequences
>2gtc-a1-m1-cD (length=97) [Search sequence]
IVTTTSGIQGKEIIEYIDIVNGEAIGANIVRDLFASVRDVVGGRAGSYESKLKEARDIAD
EKELAKQKGANAIVGVDVDYEVVRDGLVAVSGTAVRI
>2gtc-a1-m1-cE (length=97) [Search sequence]
IVTTTSGIQGKEIIEYIDIVNGEAIGANIVRDLFASVRDVVGGRAGSYESKLKEARDIAD
EKELAKQKGANAIVGVDVDYEVVRDGLVAVSGTAVRI
Structure information
PDB ID 2gtc (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the hypthetical protein from Bacillus cereus (ATCC 14579). Northeast structural genomics Target BcR11
Assembly ID 1
Resolution 2.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 97
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D E
UniProt accession Q63F05 Q63F05
Species 226900 (Bacillus cereus ATCC 14579) 226900 (Bacillus cereus ATCC 14579)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2gtc-a1-m1-cD_2gtc-a1-m1-cE.pdb.gz
Full biological assembly
Download: 2gtc-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1vr4/1/1:B/1:A 1vr4/1/1:C/1:D 1vr4/1/1:E/1:A 1vr4/1/1:E/1:D 2gtc/1/1:A/1:C 2gtc/1/1:A/1:D 2gtc/1/1:B/1:C 2gtc/1/1:B/1:E

[Back to Home]