2gtd/4/1:D/1:F

Sequences

>2gtd-a4-m1-cD (length=248) [Search sequence]

MDPMYLLVDVGNTHSVFSITEDGKTFRRWRLSTGVFQTEDELFSHLHPLLGDAMREIKGI
GVASVVPTQNTVIERFSQKYFHISPIWVKAKNGCVKWNVKNPSEVGADRVANVVAFVKEY
GKNGIIIDMGTATTVDLVVNGSYEGGAILPGFFMMVHSLFRGTAKLPLVEVKPADFVVGK
DTEENIRLGVVNGSVYALEGIIGRIKEVYGDLPVVLTGGQSKIVKDMIKHEIFDEDLTIK
GVYHFCFG

>2gtd-a4-m1-cF (length=248) [Search sequence]

Structure information

PDB ID	2gtd (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of a Type III Pantothenate Kinase: Insight into the Catalysis of an Essential Coenzyme A Biosynthetic Enzyme Universally Distributed in Bacteria
Assembly ID	4
Resolution	2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	34
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	F
UniProt accession	Q9WZY5	Q9WZY5
Species	2336 (Thermotoga maritima)	2336 (Thermotoga maritima)

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	2gtd-a4-m1-cD_2gtd-a4-m1-cF.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	2gtd-assembly4.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2gtd/4/1:A/1:D 2gtd/4/1:A/1:F 2gtd/4/1:B/1:C 2gtd/4/1:B/1:E 2gtd/4/1:C/1:E
Other dimers with similar sequences but different poses	3bex/3/1:E/1:F 2gtd/1/1:A/1:B 2gtd/2/1:C/1:D 2gtd/3/1:E/1:F 2gtd/4/1:A/1:B 2gtd/4/1:C/1:D 2gtd/4/1:E/1:F 3bex/1/1:A/1:B 3bex/2/1:C/1:D 3bf1/1/1:A/1:B 3bf1/2/1:C/1:D 3bf1/3/1:E/1:F 3bf3/1/1:A/1:B 3bf3/2/1:C/1:D 3bf3/3/1:E/1:F